PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G20980.1
Common NameATSPL14, F9H16.3, FBR6, SPL14, SPL1R2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 1035aa    MW: 114814 Da    PI: 8.4708
Description squamosa promoter binding protein-like 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G20980.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.2e-41119196178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+++
  AT1G20980.1 119 MCQVDNCTEDLSHAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTTQ 196
                  6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.5E-34112181IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.077117194IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-37118196IPR004333Transcription factor, SBP-box
PfamPF031109.1E-29120193IPR004333Transcription factor, SBP-box
CDDcd002047.05E-10785928No hitNo description
SuperFamilySSF484032.13E-7787925IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.4E-6789931IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.747869941IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000034anatomyvascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 1035 aa     Download sequence    Send to blast
MDEVGAQVAA PMFIHQSLGR KRDLYYPMSN RLVQSQPQRR DEWNSKMWDW DSRRFEAKPV  60
DVEVQEFDLT LRNRSGEERG LDLNLGSGLT AVEETTTTTQ NVRPNKKVRS GSPGGNYPMC  120
QVDNCTEDLS HAKDYHRRHK VCEVHSKATK ALVGKQMQRF CQQCSRFHLL SEFDEGKRSC  180
RRRLAGHNRR RRKTTQPEEV ASGVVVPGNH DTTNNTANAN MDLMALLTAL ACAQGKNAVK  240
PPVGSPAVPD REQLLQILNK INALPLPMDL VSKLNNIGSL ARKNMDHPTV NPQNDMNGAS  300
PSTMDLLAVL STTLGSSSPD ALAILSQGGF GNKDSEKTKL SSYENGVTTN LEKRTFGFSS  360
VGGERSSSSN QSPSQDSDSR GQDTRSSLSL QLFTSSPEDE SRPTVASSRK YYSSASSNPV  420
EDRSPSSSPV MQELFPLQAS PETMRSKNHK NSSPRTGCLP LELFGASNRG AADPNFKGFG  480
QQSGYASSGS DYSPPSLNSD AQDRTGKIVF KLLDKDPSQL PGTLRSEIYN WLSNIPSEME  540
SYIRPGCVVL SVYVAMSPAA WEQLEQKLLQ RLGVLLQNSP SDFWRNARFI VNTGRQLASH  600
KNGKVRCSKS WRTWNSPELI SVSPVAVVAG EETSLVVRGR SLTNDGISIR CTHMGSYMAM  660
EVTRAVCRQT IFDELNVNSF KVQNVHPGFL GRCFIEVENG FRGDSFPLII ANASICKELN  720
RLGEEFHPKS QDMTEEQAQS SNRGPTSREE VLCFLNELGW LFQKNQTSEL REQSDFSLAR  780
FKFLLVCSVE RDYCALIRTL LDMLVERNLV NDELNREALD MLAEIQLLNR AVKRKSTKMV  840
ELLIHYLVNP LTLSSSRKFV FLPNITGPGG ITPLHLAACT SGSDDMIDLL TNDPQEIGLS  900
SWNTLRDATG QTPYSYAAIR NNHNYNSLVA RKLADKRNKQ VSLNIEHEVV DQTGLSKRLS  960
LEMNKSSSSC ASCATVALKY QRRVSGSQRL FPTPIIHSML AVATVCVCVC VFMHAFPIVR  1020
QGSHFSWGGL DYGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-31110193384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.211920.0flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793481630.0
Genevisible262798_at0.0
Expression AtlasAT1G20980-
AtGenExpressAT1G20980-
ATTED-IIAT1G20980-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a nuclear plant-specific protein with features characteristic of a transcriptional regulator, including a nuclear localization signal sequence, a plant-specific DNA binding domain (the SBP box), and a protein interaction motif (ankyrin repeats). It unctions as a transcriptional regulator that plays a role not only in sensitivity to FB1, but also in the development of normal plant architecture.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Function -- GeneRIF ? help Back to Top
  1. SPL14 functions as a transcriptional regulator.
    [PMID: 15703061]
  2. ). DNA recognized by AtSPL14 contained the core binding motif (GTAC) found for other SBP domain proteins, but mutational analyses indicated that at least one additional flanking nucleotide is necessary for effective AtSPL14-DNA interaction.
    [PMID: 18302343]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G20980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Plants display elongated petioles and enhanced leaf margin serration and are able to germinate and develop in the presence of the programmed cell death (PCD)-inducing fungal toxin fumonisin B1 (FB1). {ECO:0000269|PubMed:15703061}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G20980
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2269070.0AK226907.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 14, clone: RAFL09-16-H09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173522.10.0squamosa promoter binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLD7KJX20.0D7KJX2_ARALL; Putative uncharacterized protein
STRINGAT1G20980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Representative plantOGRP71381115
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Stone JM,Liang X,Nekl ER,Stiers JJ
    Arabidopsis AtSPL14, a plant-specific SBP-domain transcription factor, participates in plant development and sensitivity to fumonisin B1.
    Plant J., 2005. 41(5): p. 744-54
    [PMID:15703061]
  5. Jones AM,Thomas V,Bennett MH,Mansfield J,Grant M
    Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae.
    Plant Physiol., 2006. 142(4): p. 1603-20
    [PMID:17028151]
  6. Benschop JJ, et al.
    Quantitative phosphoproteomics of early elicitor signaling in Arabidopsis.
    Mol. Cell Proteomics, 2007. 6(7): p. 1198-214
    [PMID:17317660]
  7. Liang X,Nazarenus TJ,Stone JM
    Identification of a consensus DNA-binding site for the Arabidopsis thaliana SBP domain transcription factor, AtSPL14, and binding kinetics by surface plasmon resonance.
    Biochemistry, 2008. 47(12): p. 3645-53
    [PMID:18302343]
  8. Guo AY, et al.
    Genome-wide identification and evolutionary analysis of the plant specific SBP-box transcription factor family.
    Gene, 2008. 418(1-2): p. 1-8
    [PMID:18495384]